(data stored in ACNUC7421 zone)

EMBL: AM286690.PE52

AM286690.PE52        Location/Qualifiers
FT   CDS             complement(53898..54602)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0052"
FT                   /product="conserved hypothetical protein"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15500"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG2"
FT                   /protein_id="CAL15500.1"
FT                   /translation="MKKLLPFAITLVLAGCQNMESAMPWINMGNEMAKNAGYNTDEKLA
FT                   AGIKEALIKGTDVAANQLSQEGAMNMKLPKSADPVTNTLRNFGLGSYVDQLETAMNRGA
FT                   EKAVASGAPVFKDAINAMSVEDALGIIQGGDTAATTYFRGETESSLRERFQPIVEDNLR
FT                   QTGFYDQYQTMLGTYNKLPLTNKPNLDLESYVIDNSMNELYTRIGEQETLIRQNPMQQG
FT                   SALIGAVFGNAN"
     MKKLLPFAIT LVLAGCQNME SAMPWINMGN EMAKNAGYNT DEKLAAGIKE ALIKGTDVAA        60
     NQLSQEGAMN MKLPKSADPV TNTLRNFGLG SYVDQLETAM NRGAEKAVAS GAPVFKDAIN       120
     AMSVEDALGI IQGGDTAATT YFRGETESSL RERFQPIVED NLRQTGFYDQ YQTMLGTYNK       180
     LPLTNKPNLD LESYVIDNSM NELYTRIGEQ ETLIRQNPMQ QGSALIGAVF GNAN             234
//

If you have problems or comments...

PBIL Back to PBIL home page