(data stored in ACNUC7421 zone)

EMBL: AM286690.PE520

AM286690.PE520       Location/Qualifiers
FT   CDS             complement(571213..571800)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0520"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="outer membrane lipoprotein LolB identified by match
FT                   to PFAM protein family HMMPF03550"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15968"
FT                   /db_xref="GOA:Q0VS80"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS80"
FT                   /inference="protein motif:HMMPFAM:HMMPF03550"
FT                   /protein_id="CAL15968.1"
FT                   /translation="MTLSLARIIGLTLTTLVLGACQLRPTTTTQFEHPSQIQQWQMNGK
FT                   LGYRTVNDGGSATFDWRQQPQRGNIHFSGPLGFGSADLHWDSGRAELITAKETYQARSP
FT                   GELAWHLTGFWLPVSALQYWARGLPWPGAPSEAGYDDQQRLITLEQLGWSLTFDRYEPT
FT                   AGITLPYRIKAQQNSNRFTLLIKDWQPGGGAQ"
     MTLSLARIIG LTLTTLVLGA CQLRPTTTTQ FEHPSQIQQW QMNGKLGYRT VNDGGSATFD        60
     WRQQPQRGNI HFSGPLGFGS ADLHWDSGRA ELITAKETYQ ARSPGELAWH LTGFWLPVSA       120
     LQYWARGLPW PGAPSEAGYD DQQRLITLEQ LGWSLTFDRY EPTAGITLPY RIKAQQNSNR       180
     FTLLIKDWQP GGGAQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page