(data stored in ACNUC7421 zone)

EMBL: AM286690.PE521

AM286690.PE521       Location/Qualifiers
FT   CDS             complement(571797..573395)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0521"
FT                   /product="TPR domain protein"
FT                   /function="probably mediates protein-protein interactions"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF00515"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15969"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS79"
FT                   /inference="protein motif:HMMPFAM:HMMPF00515"
FT                   /protein_id="CAL15969.1"
FT                   /translation="MASAPTYDSETLSDLLVAEVAAQRQSLGVTLGYYSRAAQSTRDPN
FT                   VISQAAQLAHYLEDPLQALAMSELWLETSPHNEDALQVAILSEIRLGNTATTTRYLDQL
FT                   LSAHGEDALGRLVNQARGLGAQGNLQLVEALAQLTHRYPDQAPLWYARALWLEHEEQPQ
FT                   PALEATERTLKLMPRHEDALLLKAQLLYETGDQKKALRHLKKLVRKYPQAQRPRIAYVR
FT                   MLLTSGELEDAEKQLAIMAEQNPQDLDLRFSLALLALEAGASNAAQTHLKALLTYNYRP
FT                   DDIQLYLAQAAEQEMDLDNAVEHYLKVGGPQAIRARVQAAQLLYQQGNTSQGHALMHNL
FT                   AQQQPKLQDSLTITEAEMRSNNGDPLGAISLINDALRDQPDNTELLYSRAMAAEKIGDI
FT                   AQLEKDLKRIIILNPEDASALNALGYTLGNRTDRLDEAYQYVSKALELRPEDPAILDSM
FT                   GWVLYKRGEPDAARNYLRQAYEKFPDPEVAAHYGEVLWILGEQNQARQVWRDALEHTPD
FT                   APHIREVMEKLGARL"
     MASAPTYDSE TLSDLLVAEV AAQRQSLGVT LGYYSRAAQS TRDPNVISQA AQLAHYLEDP        60
     LQALAMSELW LETSPHNEDA LQVAILSEIR LGNTATTTRY LDQLLSAHGE DALGRLVNQA       120
     RGLGAQGNLQ LVEALAQLTH RYPDQAPLWY ARALWLEHEE QPQPALEATE RTLKLMPRHE       180
     DALLLKAQLL YETGDQKKAL RHLKKLVRKY PQAQRPRIAY VRMLLTSGEL EDAEKQLAIM       240
     AEQNPQDLDL RFSLALLALE AGASNAAQTH LKALLTYNYR PDDIQLYLAQ AAEQEMDLDN       300
     AVEHYLKVGG PQAIRARVQA AQLLYQQGNT SQGHALMHNL AQQQPKLQDS LTITEAEMRS       360
     NNGDPLGAIS LINDALRDQP DNTELLYSRA MAAEKIGDIA QLEKDLKRII ILNPEDASAL       420
     NALGYTLGNR TDRLDEAYQY VSKALELRPE DPAILDSMGW VLYKRGEPDA ARNYLRQAYE       480
     KFPDPEVAAH YGEVLWILGE QNQARQVWRD ALEHTPDAPH IREVMEKLGA RL               532
//

If you have problems or comments...

PBIL Back to PBIL home page