(data stored in ACNUC7421 zone)

EMBL: AM286690.PE53

AM286690.PE53        Location/Qualifiers
FT   CDS             54715..55335
FT                   /transl_table=11
FT                   /locus_tag="ABO_0053"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="(conserved hypothetical protein homologous to
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase) identified by match to PFAM protein
FT                   family HMMPF00132 InterPro: Bacterial transferase
FT                   hexapeptide repeat"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15501"
FT                   /db_xref="GOA:Q0VTG1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG1"
FT                   /inference="protein motif:HMMPFAM:HMMPF00132"
FT                   /protein_id="CAL15501.1"
FT                   /translation="MSEDDYREQHKQRLAYMPWLYGRLKLRHRAWVEPWQQGIQQRLMA
FT                   LETVHCGTDCFVAPQAVLLAEPGRDIFVGDGCQIAADCVIHGPVRLGQRVSINHHVSLE
FT                   GGAAGIEIGDDTRIAAYCTLFAFNHGMEADRLVREQPVNSRGIRIGCDVWIGARVGIVD
FT                   GVTLGDHAVVGMGAVVTRDVPPWTIVAGNPARPIGRRPGAPSC"
     MSEDDYREQH KQRLAYMPWL YGRLKLRHRA WVEPWQQGIQ QRLMALETVH CGTDCFVAPQ        60
     AVLLAEPGRD IFVGDGCQIA ADCVIHGPVR LGQRVSINHH VSLEGGAAGI EIGDDTRIAA       120
     YCTLFAFNHG MEADRLVREQ PVNSRGIRIG CDVWIGARVG IVDGVTLGDH AVVGMGAVVT       180
     RDVPPWTIVA GNPARPIGRR PGAPSC                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page