(data stored in ACNUC7421 zone)

EMBL: AM286690.PE534

AM286690.PE534       Location/Qualifiers
FT   CDS             586232..590053
FT                   /transl_table=11
FT                   /locus_tag="ABO_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15982"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS66"
FT                   /protein_id="CAL15982.1"
FT                   /translation="MVLTRFARWRRFFPSLWWTVATVLLLMAAYVVVGRQLMLLVPDYR
FT                   ERLEQIFEKRIQTPLTIAELNGTMSGLVPQFVARQIRLPAPEGEAPLVLGEVVLSIDVL
FT                   RSLWHRDLVLEELSVRGVDLSLVRGDDGKIRLRGLDVLGQSDPDNRPPLERILKLFYRQ
FT                   QLLSISDARLSLEWPGMPPLAASELDATMTNDGDEHRLAVRVEARDRPLSLLAKIHLHE
FT                   DAYTLDQVDADIFTRFEGKRLNEWLPQIDAMPLELGSLDASVALWGTLQGGEPTSGQLQ
FT                   VDVPALTLFQADTVLPLSGLSLRASLLREDQKATLSLSNLTGNSPTGPLTLGDMALRWE
FT                   TQGERREWQLRANALPLHAITQQFKDWPFTLPKLASEWREKIAVASPRGVVEGVYLSGH
FT                   ARDLEQFQVRFAGLASEADDNIPGVKGLNGWVAGSPNQGLAHLYSDNVSLQLPRLYDHA
FT                   LGGQLAGVFGWQREGEALSVRSSRLRVVNPDAYGEAMMAVTLRPGEIPELRLAAEIYDG
FT                   NGARASHYIPLKPLPDGLSGWLSQAIGDGHLQRGQLLYQGPVKIDKSRQQDRTFQMRYQ
FT                   ADDVRLSFLPDWPEATGVKADVWVNGREVQGVASQGSLLNSQLTEVHVDVPAFDDESGP
FT                   SVIVAGQVSGPLEDLDTVFQNTPLAEQLPQEVKDWRYLGGNMKGQLTLNIPLKKGSTSP
FT                   MVIVNASVADGQVENRERNLLITDVQAPVYFHLRNGLQMSRLSASTLGGEVTGKWITGS
FT                   GKSTLTLDGEVPVESLRNWLGFDWLAPASGSLPLAMAIQVPWQGNSFALHATSSLKGVI
FT                   VDAPVPLGKTASQSRNLALDLTHNGQHLALQYGDTVRGAFALNETVRGGVRLGVGTPHI
FT                   PASGIDVQGRLARASAQAWIDFVSNELLPAMDSNASGGGGNGAQQGGLNKVNVQVATLD
FT                   LFGVDVSEASLSVLPRANGWDLALSSPSVAGSVAIPEGFSARGKVPLDLSVSRMNLTLP
FT                   DSADPQSGAPLSPMDLPSVNARLANLRIDGEDFGQWQAELRPTEQGLRINDLQGRWRAS
FT                   RILGTVDWTEDDGAQYTRFNGSLTSDNLGRSLRAWGLPEMIESEDATAKVSLGWAQWPL
FT                   APNYLALNGQARVDIGECRIPDTDTKTSFLRLLGILNLGTIQRRLRLDFSDLYKKGLSC
FT                   DSITGDFALDGPHVSTSNLAIDSPSAAIRVKGTINLEKETLNHQMEVTLPLSSNLYAGC
FT                   LAGPAACAGIFVVERIWGDELDKTATMEYRVSGSWSGPDVSETEGIFE"
     MVLTRFARWR RFFPSLWWTV ATVLLLMAAY VVVGRQLMLL VPDYRERLEQ IFEKRIQTPL        60
     TIAELNGTMS GLVPQFVARQ IRLPAPEGEA PLVLGEVVLS IDVLRSLWHR DLVLEELSVR       120
     GVDLSLVRGD DGKIRLRGLD VLGQSDPDNR PPLERILKLF YRQQLLSISD ARLSLEWPGM       180
     PPLAASELDA TMTNDGDEHR LAVRVEARDR PLSLLAKIHL HEDAYTLDQV DADIFTRFEG       240
     KRLNEWLPQI DAMPLELGSL DASVALWGTL QGGEPTSGQL QVDVPALTLF QADTVLPLSG       300
     LSLRASLLRE DQKATLSLSN LTGNSPTGPL TLGDMALRWE TQGERREWQL RANALPLHAI       360
     TQQFKDWPFT LPKLASEWRE KIAVASPRGV VEGVYLSGHA RDLEQFQVRF AGLASEADDN       420
     IPGVKGLNGW VAGSPNQGLA HLYSDNVSLQ LPRLYDHALG GQLAGVFGWQ REGEALSVRS       480
     SRLRVVNPDA YGEAMMAVTL RPGEIPELRL AAEIYDGNGA RASHYIPLKP LPDGLSGWLS       540
     QAIGDGHLQR GQLLYQGPVK IDKSRQQDRT FQMRYQADDV RLSFLPDWPE ATGVKADVWV       600
     NGREVQGVAS QGSLLNSQLT EVHVDVPAFD DESGPSVIVA GQVSGPLEDL DTVFQNTPLA       660
     EQLPQEVKDW RYLGGNMKGQ LTLNIPLKKG STSPMVIVNA SVADGQVENR ERNLLITDVQ       720
     APVYFHLRNG LQMSRLSAST LGGEVTGKWI TGSGKSTLTL DGEVPVESLR NWLGFDWLAP       780
     ASGSLPLAMA IQVPWQGNSF ALHATSSLKG VIVDAPVPLG KTASQSRNLA LDLTHNGQHL       840
     ALQYGDTVRG AFALNETVRG GVRLGVGTPH IPASGIDVQG RLARASAQAW IDFVSNELLP       900
     AMDSNASGGG GNGAQQGGLN KVNVQVATLD LFGVDVSEAS LSVLPRANGW DLALSSPSVA       960
     GSVAIPEGFS ARGKVPLDLS VSRMNLTLPD SADPQSGAPL SPMDLPSVNA RLANLRIDGE      1020
     DFGQWQAELR PTEQGLRIND LQGRWRASRI LGTVDWTEDD GAQYTRFNGS LTSDNLGRSL      1080
     RAWGLPEMIE SEDATAKVSL GWAQWPLAPN YLALNGQARV DIGECRIPDT DTKTSFLRLL      1140
     GILNLGTIQR RLRLDFSDLY KKGLSCDSIT GDFALDGPHV STSNLAIDSP SAAIRVKGTI      1200
     NLEKETLNHQ MEVTLPLSSN LYAGCLAGPA ACAGIFVVER IWGDELDKTA TMEYRVSGSW      1260
     SGPDVSETEG IFE                                                         1273
//

If you have problems or comments...

PBIL Back to PBIL home page