(data stored in ACNUC7421 zone)

EMBL: AM286690.PE55

AM286690.PE55        Location/Qualifiers
FT   CDS             56321..58141
FT                   /transl_table=11
FT                   /locus_tag="ABO_0055"
FT                   /product="acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="acyltransferase identified by match to PFAM protein
FT                   family HMMPF04241 InterPro: Phospholipid and glycerol
FT                   acyltransferase (from motifs_6.msf)"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15503"
FT                   /db_xref="GOA:Q0VTF9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF9"
FT                   /inference="protein motif:HMMPFAM:HMMPF04241"
FT                   /protein_id="CAL15503.1"
FT                   /translation="MGAFNDNVFRQALILLIASGVVSTVSVNTLNNVALALFIVPFFLF
FT                   SALAGQVADKYDKATLVRKIKMVEVFIMCAAAVGFFFDGVYFLLAVLFCMGLQSTFFGP
FT                   IKYSIIPQHLTDKELVSGNALVEMGTFLAILLGSISGVFLKMDGVGDGVVAMTVVGLAL
FT                   LGYLAARGIPAAPAADSSIKINWNLWKETWHIVGYAREVKSVWMCVLAISWFWFMGAAY
FT                   TTQLKVYVDDYLFGTDGLYALLLGTFSVGIGLGSFLCEKLSGKRVELGLVPLGSIGLSV
FT                   FGIDLFFSYAGLAGVGSVTNNNIGVASFLQQPGGYRVLLDLLGIGVFGGFYIVPLFAFI
FT                   QHRANPKHLSRIIAANNILNALLMVLSAVAGIVLVGLLEITVPQFFLALALSNILVAAY
FT                   IYTVVPEFLIRLLVWMLTHTMYRVKHTGMDNIPDEGPCMLVCNHVSYVDALLLAGAIRR
FT                   PVRFVMFKPIYDMPVLNYIFRTGKTIPIDSKSRNPKIYEQAFVRIREELAAGEVVCIFP
FT                   EGRLTEDGEIDEFRAGIEKIVSDSPVPVIPMALSGLWGSVFSHKGGKALTHLPRRFWSR
FT                   IKLAVGTGVSPQEVQASDLRKRVLALRECP"
     MGAFNDNVFR QALILLIASG VVSTVSVNTL NNVALALFIV PFFLFSALAG QVADKYDKAT        60
     LVRKIKMVEV FIMCAAAVGF FFDGVYFLLA VLFCMGLQST FFGPIKYSII PQHLTDKELV       120
     SGNALVEMGT FLAILLGSIS GVFLKMDGVG DGVVAMTVVG LALLGYLAAR GIPAAPAADS       180
     SIKINWNLWK ETWHIVGYAR EVKSVWMCVL AISWFWFMGA AYTTQLKVYV DDYLFGTDGL       240
     YALLLGTFSV GIGLGSFLCE KLSGKRVELG LVPLGSIGLS VFGIDLFFSY AGLAGVGSVT       300
     NNNIGVASFL QQPGGYRVLL DLLGIGVFGG FYIVPLFAFI QHRANPKHLS RIIAANNILN       360
     ALLMVLSAVA GIVLVGLLEI TVPQFFLALA LSNILVAAYI YTVVPEFLIR LLVWMLTHTM       420
     YRVKHTGMDN IPDEGPCMLV CNHVSYVDAL LLAGAIRRPV RFVMFKPIYD MPVLNYIFRT       480
     GKTIPIDSKS RNPKIYEQAF VRIREELAAG EVVCIFPEGR LTEDGEIDEF RAGIEKIVSD       540
     SPVPVIPMAL SGLWGSVFSH KGGKALTHLP RRFWSRIKLA VGTGVSPQEV QASDLRKRVL       600
     ALRECP                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page