(data stored in ACNUC7421 zone)

EMBL: AM286690.PE551

AM286690.PE551       Location/Qualifiers
FT   CDS             complement(610446..610745)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0551"
FT                   /product="Sigma 54 modulation protein / S30EA r"
FT                   /note="sigma54 modulation protein) identified by sequence
FT                   similarity;putative InterPro: Sigma 54 modulation protein /
FT                   S30EA ribosomal protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15999"
FT                   /db_xref="GOA:Q0VS49"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS49"
FT                   /protein_id="CAL15999.1"
FT                   /translation="MQINISGHHLEITDALRTYVGDKFSRLERHFDQITSIQVILSPEP
FT                   KSHKAESTIHISGADVFATAEADDMYAAIDKLTDKLDRQILKHKEKAVSHKHGH"
     MQINISGHHL EITDALRTYV GDKFSRLERH FDQITSIQVI LSPEPKSHKA ESTIHISGAD        60
     VFATAEADDM YAAIDKLTDK LDRQILKHKE KAVSHKHGH                               99
//

If you have problems or comments...

PBIL Back to PBIL home page