(data stored in ACNUC7421 zone)

EMBL: AM286690.PE558

AM286690.PE558       Location/Qualifiers
FT   CDS             615988..616635
FT                   /transl_table=11
FT                   /locus_tag="ABO_0558"
FT                   /product="toluene-tolerance protein"
FT                   /note="(ttg2D) identified by sequence similarity; This
FT                   family is a transporter which shows similarity to ABC
FT                   transporters"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16006"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS42"
FT                   /protein_id="CAL16006.1"
FT                   /translation="MHLQWYMAAWLRVGLVVMLTAMAALVQAQSDPRQVVADAVERMTS
FT                   RVEAERETLKADPDRAKELVREELADLVDFKRITRMVMGDYFGPSSKEQKYRFLDVFKN
FT                   SLINTYASGITLYDGQKIDILPMQDGDRKGDYARVRMEVKTNSGQVVPIYYTLFLRDDQ
FT                   WRVINVYVNGLDLRDTFKSQFAQGMQQYNDIDKVVDNWSADAKIDAGLKEEG"
     MHLQWYMAAW LRVGLVVMLT AMAALVQAQS DPRQVVADAV ERMTSRVEAE RETLKADPDR        60
     AKELVREELA DLVDFKRITR MVMGDYFGPS SKEQKYRFLD VFKNSLINTY ASGITLYDGQ       120
     KIDILPMQDG DRKGDYARVR MEVKTNSGQV VPIYYTLFLR DDQWRVINVY VNGLDLRDTF       180
     KSQFAQGMQQ YNDIDKVVDN WSADAKIDAG LKEEG                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page