(data stored in ACNUC7421 zone)

EMBL: AM286690.PE564

AM286690.PE564       Location/Qualifiers
FT   CDS             621924..623522
FT                   /transl_table=11
FT                   /locus_tag="ABO_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16012"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR025554"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS36"
FT                   /protein_id="CAL16012.1"
FT                   /translation="MKRVLLLTCALIPLSLFAADFAVTAPVNKAVLFPAQAHLTRTFSQ
FT                   ALPAGEHQLVVKGLPELDLDSLQVAVNGAELLAIRQGFAVGDVDVSAHRAELEAAIRKL
FT                   EQAMAEAKAADDLDQQQINHLQSLMGQAPQGQAVFAQVPVEKWASAWESIGKAVTQRQT
FT                   AINQRAEIRHGQQQELDALRQERQLLGQGQTRSRQLILTVAAPNKSTAQVELAYFTGQA
FT                   GWQNQLRVDLDSGNETVAVTGIAQIHNRTGEDWQNVSATLGLVPAGYRPLPDLHPWLVR
FT                   LATPQPAMRKSSLHSVMAESAAYETDMAQRIQAMPVAAPVAHGFDMRVPLSAPLNLASG
FT                   DATARLPYQQAALPVTLTRESYLWQQPAVLLVGEWQNSSPLPWLPGHVTLLRDGQRLAR
FT                   YYRGNSIKQGEHVKMSFGDDPRLQIAVVREPSQQGEVGLINKESTLSALKNITLSSHYD
FT                   KAVTVNLLDRLPVAGNDNITITAKGKAADAKDVSGVKGLQRWQFTLPAGGEESLKQGFE
FT                   IRYPEDAILSGVEGL"
     MKRVLLLTCA LIPLSLFAAD FAVTAPVNKA VLFPAQAHLT RTFSQALPAG EHQLVVKGLP        60
     ELDLDSLQVA VNGAELLAIR QGFAVGDVDV SAHRAELEAA IRKLEQAMAE AKAADDLDQQ       120
     QINHLQSLMG QAPQGQAVFA QVPVEKWASA WESIGKAVTQ RQTAINQRAE IRHGQQQELD       180
     ALRQERQLLG QGQTRSRQLI LTVAAPNKST AQVELAYFTG QAGWQNQLRV DLDSGNETVA       240
     VTGIAQIHNR TGEDWQNVSA TLGLVPAGYR PLPDLHPWLV RLATPQPAMR KSSLHSVMAE       300
     SAAYETDMAQ RIQAMPVAAP VAHGFDMRVP LSAPLNLASG DATARLPYQQ AALPVTLTRE       360
     SYLWQQPAVL LVGEWQNSSP LPWLPGHVTL LRDGQRLARY YRGNSIKQGE HVKMSFGDDP       420
     RLQIAVVREP SQQGEVGLIN KESTLSALKN ITLSSHYDKA VTVNLLDRLP VAGNDNITIT       480
     AKGKAADAKD VSGVKGLQRW QFTLPAGGEE SLKQGFEIRY PEDAILSGVE GL               532
//

If you have problems or comments...

PBIL Back to PBIL home page