(data stored in ACNUC7421 zone)

EMBL: AM286690.PE568

AM286690.PE568       Location/Qualifiers
FT   CDS             complement(627170..627703)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequencesimilarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16016"
FT                   /db_xref="GOA:Q0VS32"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS32"
FT                   /protein_id="CAL16016.1"
FT                   /translation="MDMLTTGVLCFAAGVVTGAGLLFWLLPARRQAGQLIRDRDEARQA
FT                   LNHYRDKVDDHFLQTADLVNDMTQAYRSVHEHLSKGVQVLCSEVGRKRAVAKSLDSAPG
FT                   NDNSEPMTPPLDYAPSAKGTLSEDFGLQQKPTGPFAPVDVADNPLPDIVVQPPRDYADG
FT                   DTQDTDTTSNKTPG"
     MDMLTTGVLC FAAGVVTGAG LLFWLLPARR QAGQLIRDRD EARQALNHYR DKVDDHFLQT        60
     ADLVNDMTQA YRSVHEHLSK GVQVLCSEVG RKRAVAKSLD SAPGNDNSEP MTPPLDYAPS       120
     AKGTLSEDFG LQQKPTGPFA PVDVADNPLP DIVVQPPRDY ADGDTQDTDT TSNKTPG          177
//

If you have problems or comments...

PBIL Back to PBIL home page