(data stored in ACNUC7421 zone)

EMBL: AM286690.PE569

AM286690.PE569       Location/Qualifiers
FT   CDS             627820..628452
FT                   /transl_table=11
FT                   /locus_tag="ABO_0569"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted hydrolase of the alpha"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Esterase/lipase/thioesterase family active site"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16017"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS31"
FT                   /protein_id="CAL16017.1"
FT                   /translation="MMAQRQTLPGPAGELEVVVEYGSEAPPFVAIVCHPHPLFGGTMDN
FT                   KVVTTLARLARDEGAVVVRFNFRGVGESQGAYSDGIGETEDLLAIHSWLTHKYPQLPLW
FT                   LSGFSFGSFVAARGAEILKANGVPARELLLVAPPVHHYPFDEIEDTGCPVTVVQGDDDE
FT                   VVPAEQVYRWAEQTPLAPDLLRFPDCGHFFHGKLVDLKQVAASHLPR"
     MMAQRQTLPG PAGELEVVVE YGSEAPPFVA IVCHPHPLFG GTMDNKVVTT LARLARDEGA        60
     VVVRFNFRGV GESQGAYSDG IGETEDLLAI HSWLTHKYPQ LPLWLSGFSF GSFVAARGAE       120
     ILKANGVPAR ELLLVAPPVH HYPFDEIEDT GCPVTVVQGD DDEVVPAEQV YRWAEQTPLA       180
     PDLLRFPDCG HFFHGKLVDL KQVAASHLPR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page