(data stored in ACNUC7421 zone)

EMBL: AM286690.PE57

AM286690.PE57        Location/Qualifiers
FT   CDS             58962..60218
FT                   /transl_table=11
FT                   /locus_tag="ABO_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15505"
FT                   /db_xref="GOA:Q0VTF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF7"
FT                   /protein_id="CAL15505.1"
FT                   /translation="MITDLNLILADVQANWALYLSMPFVAAAIGYGTKVVAIKMMFKPL
FT                   QFVGWRPFFGWQGIVPGKAATMASIACDLMMERLLKPEDVFNKLDPHRVAEEIREPLIR
FT                   SVEDITREVAAEYQPGLWEAAPESVKRLIIKRIQNEAPHMVEQIMEDIKNNITRVFDLK
FT                   DLVINALVRDKELLNRVFLEAGHVEFKFIRNSGIYFGFAIGLIQAVVWAFTHNIWVIPL
FT                   FGLFTGWFTDWLALKMIFNPKKPVRYLGLFEWQGLFLKRRKQVAARYGELVASEIVTPA
FT                   AVIEAILKGPMSDRLFGLVQKQVQRTLDEQSGVAKPLVVFAVGSTKYQEMKRSVSEKVM
FT                   QYLPETLSHMEAYAEEAMDLKNLMVEKMQELTEEEFEGLLRPAFQQDEWILITVGAILG
FT                   FLVGEMQVHVMIHFAVPVV"
     MITDLNLILA DVQANWALYL SMPFVAAAIG YGTKVVAIKM MFKPLQFVGW RPFFGWQGIV        60
     PGKAATMASI ACDLMMERLL KPEDVFNKLD PHRVAEEIRE PLIRSVEDIT REVAAEYQPG       120
     LWEAAPESVK RLIIKRIQNE APHMVEQIME DIKNNITRVF DLKDLVINAL VRDKELLNRV       180
     FLEAGHVEFK FIRNSGIYFG FAIGLIQAVV WAFTHNIWVI PLFGLFTGWF TDWLALKMIF       240
     NPKKPVRYLG LFEWQGLFLK RRKQVAARYG ELVASEIVTP AAVIEAILKG PMSDRLFGLV       300
     QKQVQRTLDE QSGVAKPLVV FAVGSTKYQE MKRSVSEKVM QYLPETLSHM EAYAEEAMDL       360
     KNLMVEKMQE LTEEEFEGLL RPAFQQDEWI LITVGAILGF LVGEMQVHVM IHFAVPVV         418
//

If you have problems or comments...

PBIL Back to PBIL home page