(data stored in ACNUC7421 zone)

EMBL: AM286690.PE570

AM286690.PE570       Location/Qualifiers
FT   CDS             628593..629675
FT                   /transl_table=11
FT                   /locus_tag="ABO_0570"
FT                   /product="AFG1-like ATPase, putative"
FT                   /function="ATPase"
FT                   /note="(AFG1-like ATPase, putative)identify by similarity
FT                   to Pfam protein family PF03969 (AFG1_ATPase)."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16018"
FT                   /db_xref="GOA:Q0VS30"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS30"
FT                   /protein_id="CAL16018.1"
FT                   /translation="MTPLEQYKADLERADFFQDPAQERAVAALDELYHRLLAEPASGGL
FT                   FGRFRKARPQMGLYMWGGVGRGKTYLMDVFFQTLPFEEKRRMHFHRFMQKVHREMRERQ
FT                   GEKNPLISIARKFASQARVLCFDEFFVTDITDAMILAGLMQELFANGVTLVATSNIEPD
FT                   GLYKDGLQRARFLPAIDLLKEHTQVLNVDGGNDYRLRLLEQAELYHCPLGKGADAFLQE
FT                   RFETLEQDHSRHRDRGNVLIEGRKIATVICADDVVWFEFKELCDGPRSQTDYIEIAREF
FT                   HTVLLANVEQMGASKDDMARRFINLVDEFYDRAVKLVITAEVPIEDIYAGGRLDFEFER
FT                   TCSRLQEMQSSEYLGREHRA"
     MTPLEQYKAD LERADFFQDP AQERAVAALD ELYHRLLAEP ASGGLFGRFR KARPQMGLYM        60
     WGGVGRGKTY LMDVFFQTLP FEEKRRMHFH RFMQKVHREM RERQGEKNPL ISIARKFASQ       120
     ARVLCFDEFF VTDITDAMIL AGLMQELFAN GVTLVATSNI EPDGLYKDGL QRARFLPAID       180
     LLKEHTQVLN VDGGNDYRLR LLEQAELYHC PLGKGADAFL QERFETLEQD HSRHRDRGNV       240
     LIEGRKIATV ICADDVVWFE FKELCDGPRS QTDYIEIARE FHTVLLANVE QMGASKDDMA       300
     RRFINLVDEF YDRAVKLVIT AEVPIEDIYA GGRLDFEFER TCSRLQEMQS SEYLGREHRA       360
//

If you have problems or comments...

PBIL Back to PBIL home page