(data stored in ACNUC7421 zone)

EMBL: AM286690.PE573

AM286690.PE573       Location/Qualifiers
FT   CDS             632637..632762
FT                   /transl_table=11
FT                   /locus_tag="ABO_0573"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="unknown"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS27"
FT                   /protein_id="CAL16021.1"
FT                   /translation="MQRIGRCDQVALKAADDPAAVIGAPGGSVAGCYCGLGALQE"
     MQRIGRCDQV ALKAADDPAA VIGAPGGSVA GCYCGLGALQ E                            41
//

If you have problems or comments...

PBIL Back to PBIL home page