(data stored in ACNUC7421 zone)

EMBL: AM286690.PE574

AM286690.PE574       Location/Qualifiers
FT   CDS             complement(632772..633602)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16022"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS26"
FT                   /protein_id="CAL16022.1"
FT                   /translation="MIACAAIDAIVDGLFITVAISSLKGLPLSKKCSWAKLCTCLSGSL
FT                   LGFSAPWPSRWHCTRRTVVRLPEADGEPLGQWGHGAPAHRLLVVGESTAAGVGVLHHHQ
FT                   GLASQLALQLHQQSGQAVAWHTFGVNGIRVEELLARLADTALPPVDQIFISMGVNDTTG
FT                   FTSRRRYRIGLLQLIEALSKQHPHIRITLLAVPPMHKFTALPILLRQLLGWRARQLDQQ
FT                   HRRVARNVSLARYLDYPALQDPALLAKDGYHPNASGYRAMAAALTEQKSSKQKT"
     MIACAAIDAI VDGLFITVAI SSLKGLPLSK KCSWAKLCTC LSGSLLGFSA PWPSRWHCTR        60
     RTVVRLPEAD GEPLGQWGHG APAHRLLVVG ESTAAGVGVL HHHQGLASQL ALQLHQQSGQ       120
     AVAWHTFGVN GIRVEELLAR LADTALPPVD QIFISMGVND TTGFTSRRRY RIGLLQLIEA       180
     LSKQHPHIRI TLLAVPPMHK FTALPILLRQ LLGWRARQLD QQHRRVARNV SLARYLDYPA       240
     LQDPALLAKD GYHPNASGYR AMAAALTEQK SSKQKT                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page