(data stored in ACNUC7421 zone)

EMBL: AM286690.PE585

AM286690.PE585       Location/Qualifiers
FT   CDS             complement(641334..641711)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0585"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="InterPro: Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16033"
FT                   /db_xref="GOA:Q0VS15"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS15"
FT                   /protein_id="CAL16033.1"
FT                   /translation="MPLLRSKKNTGRDAEKRAAKWLTGQGLSIVERNFHCRQGEIDLIL
FT                   LDQETLVFTEVRWRKHQSYGGALASVDQHKQRRLINAAQHFLARHPEHHHRPCRFDVLG
FT                   MEPDSQQAVLYQWIQNAFYSE"
     MPLLRSKKNT GRDAEKRAAK WLTGQGLSIV ERNFHCRQGE IDLILLDQET LVFTEVRWRK        60
     HQSYGGALAS VDQHKQRRLI NAAQHFLARH PEHHHRPCRF DVLGMEPDSQ QAVLYQWIQN       120
     AFYSE                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page