(data stored in ACNUC7421 zone)

EMBL: AM286690.PE588

AM286690.PE588       Location/Qualifiers
FT   CDS             645037..645870
FT                   /transl_table=11
FT                   /locus_tag="ABO_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16036"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS12"
FT                   /protein_id="CAL16036.1"
FT                   /translation="MLLGYRPRLRGAESSMAQVDTLFSEDGHEVLRFADLVVGEGVQAN
FT                   QFCIRHNDRAALIDPGGDLTYTPLAIALSRRVNLDGLDYILASHQDPDIIASLPRWLMH
FT                   TRCQVVVSRLWSRFLPHLASSYVTGKMGEQLQARILGVADEGKVLPFAGTELWVLPAHF
FT                   LHSVGNFSFYDPLSGILFSGDIGASLDGEEGQVDNFADHCHSMLGFHRRYMASNRACRL
FT                   WVAMVRKLAPRMIVPQHGGYFEGANVDHFLGWLASLECGVDLLDSGNYRLPSRYG"
     MLLGYRPRLR GAESSMAQVD TLFSEDGHEV LRFADLVVGE GVQANQFCIR HNDRAALIDP        60
     GGDLTYTPLA IALSRRVNLD GLDYILASHQ DPDIIASLPR WLMHTRCQVV VSRLWSRFLP       120
     HLASSYVTGK MGEQLQARIL GVADEGKVLP FAGTELWVLP AHFLHSVGNF SFYDPLSGIL       180
     FSGDIGASLD GEEGQVDNFA DHCHSMLGFH RRYMASNRAC RLWVAMVRKL APRMIVPQHG       240
     GYFEGANVDH FLGWLASLEC GVDLLDSGNY RLPSRYG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page