(data stored in ACNUC7421 zone)

EMBL: AM286690.PE589

AM286690.PE589       Location/Qualifiers
FT   CDS             646221..646661
FT                   /transl_table=11
FT                   /locus_tag="ABO_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="(conserved hypothetical protein TIGR00242)
FT                   identified by match to PFAM protein family HMMPF02381
FT                   InterPro: Domain of unknown function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16037"
FT                   /db_xref="GOA:Q0VS11"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS11"
FT                   /inference="protein motif:HMMPFAM:HMMPF02381"
FT                   /protein_id="CAL16037.1"
FT                   /translation="MFTGSAALNLDAKGRLTMPTRYRASLIDTCGGQLVLTLHPFDDCL
FT                   ALYPRAEFMDTAKKLSEQRDSNPQVRQLKRRFLGQAAEIEMDGSGRLLVPPELRAAINL
FT                   EKRAMLIGQLHRFEIWKEESWADVDGTLDPAALPESVQELSF"
     MFTGSAALNL DAKGRLTMPT RYRASLIDTC GGQLVLTLHP FDDCLALYPR AEFMDTAKKL        60
     SEQRDSNPQV RQLKRRFLGQ AAEIEMDGSG RLLVPPELRA AINLEKRAML IGQLHRFEIW       120
     KEESWADVDG TLDPAALPES VQELSF                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page