(data stored in ACNUC7421 zone)

EMBL: AM286690.PE63

AM286690.PE63        Location/Qualifiers
FT   CDS             complement(65166..67400)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15511"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019938"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF1"
FT                   /protein_id="CAL15511.1"
FT                   /translation="MRVKSGIMTATAIPRLGSPAMEINVNFLDNLRLEAKFDDFTVITD
FT                   QPIRYKGDGSAPSPFDYFLASSAMCAAYFVKVYCKARDIPTDNIRLSQNNIVDPEDRYN
FT                   QIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPDFQIEQVDSLTEDAQALLMVE
FT                   PDEAHRTFIEGKDLPLEQTIANMTAILAKLGMKIEIASWRNIVPHVWSLHVRDAASPMC
FT                   FTNGKGATKEAALCSALGEFIERLNCNFFYNDQFFGEEIANSNFVHYPNEKWFKPGPND
FT                   ALPEGILDDYCLGIYNPEGELGGSNLIDTNSGRADRGICSLPFVRQSDGETVYFPSNLI
FT                   ENLFLSNGMSAGNTLAEAKVQCLSEIFERAVKKHIIEEEIALPDVPQEVLAKYPGIVEG
FT                   ITALEEQGFPVLVKDASLGGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELL
FT                   QGRSFEGLNDLPPPTFNSQEVCEPNNFVEHFIDSSGVVSWRFFSAQADESFCEWDFSGT
FT                   TEEESARLFGILESLEKEAYVAVYEELGAPVCRILVPDFSEVYPVEDLVWDNTNMALDY
FT                   REDILNLHRLSDEQLSQLVERLEESQIDNYTDIITLIGIEFDENTVWGQLTILELKLLI
FT                   YLALQRHEDALELVDMFIQFNDNTVERGLFYRAVNAVLEITLDEELSLDDYRTNLGRMY
FT                   GEDTLETVIGAVEGSLRFPGLTPTNMQLEGLEKHQRLIESYKKLHAARAK"
     MRVKSGIMTA TAIPRLGSPA MEINVNFLDN LRLEAKFDDF TVITDQPIRY KGDGSAPSPF        60
     DYFLASSAMC AAYFVKVYCK ARDIPTDNIR LSQNNIVDPE DRYNQIFKIQ VELPEDISDK       120
     DRQGILRSID RCTVKKVVQT GPDFQIEQVD SLTEDAQALL MVEPDEAHRT FIEGKDLPLE       180
     QTIANMTAIL AKLGMKIEIA SWRNIVPHVW SLHVRDAASP MCFTNGKGAT KEAALCSALG       240
     EFIERLNCNF FYNDQFFGEE IANSNFVHYP NEKWFKPGPN DALPEGILDD YCLGIYNPEG       300
     ELGGSNLIDT NSGRADRGIC SLPFVRQSDG ETVYFPSNLI ENLFLSNGMS AGNTLAEAKV       360
     QCLSEIFERA VKKHIIEEEI ALPDVPQEVL AKYPGIVEGI TALEEQGFPV LVKDASLGGQ       420
     FPVMCVTLMN PRTGGVFASF GAHPSFEVAL ERSLTELLQG RSFEGLNDLP PPTFNSQEVC       480
     EPNNFVEHFI DSSGVVSWRF FSAQADESFC EWDFSGTTEE ESARLFGILE SLEKEAYVAV       540
     YEELGAPVCR ILVPDFSEVY PVEDLVWDNT NMALDYREDI LNLHRLSDEQ LSQLVERLEE       600
     SQIDNYTDII TLIGIEFDEN TVWGQLTILE LKLLIYLALQ RHEDALELVD MFIQFNDNTV       660
     ERGLFYRAVN AVLEITLDEE LSLDDYRTNL GRMYGEDTLE TVIGAVEGSL RFPGLTPTNM       720
     QLEGLEKHQR LIESYKKLHA ARAK                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page