(data stored in ACNUC7421 zone)

EMBL: AM286690.PE64

AM286690.PE64        Location/Qualifiers
FT   CDS             67549..68013
FT                   /transl_table=11
FT                   /locus_tag="ABO_0064"
FT                   /product="hemerythrin-like protein"
FT                   /note="hemerythrin-like protein (family member ship)
FT                   identified by sequencesimilarity; putative InterPro:
FT                   Hemerythrin"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15512"
FT                   /db_xref="GOA:Q0VTF0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF0"
FT                   /protein_id="CAL15512.1"
FT                   /translation="MRLVWGPAYELGILVIDQQHKRIVDYINDLDRLVGQPGAQLGVAR
FT                   VLYDLVDYTESHFSFEEALMERAGYDKLDDHHSQHRKFIFHIESLLRRHEEGVDVAESL
FT                   LRVLEKWLFHHILEEDRAYTQQVRDFVDGIGRERLGGWVNENLRKHFRMM"
     MRLVWGPAYE LGILVIDQQH KRIVDYINDL DRLVGQPGAQ LGVARVLYDL VDYTESHFSF        60
     EEALMERAGY DKLDDHHSQH RKFIFHIESL LRRHEEGVDV AESLLRVLEK WLFHHILEED       120
     RAYTQQVRDF VDGIGRERLG GWVNENLRKH FRMM                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page