(data stored in ACNUC7421 zone)

EMBL: AM286690.PE65

AM286690.PE65        Location/Qualifiers
FT   CDS             complement(68167..68418)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15513"
FT                   /db_xref="InterPro:IPR032036"
FT                   /db_xref="InterPro:IPR038316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE9"
FT                   /protein_id="CAL15513.1"
FT                   /translation="MRASPMKKLKNEKELVKKAIQIGVAYAEKRGVVEFEATDSASEKL
FT                   LYIYRLLVHDKIIQPLPEDQVSQPTIQHKLAIWASKQP"
     MRASPMKKLK NEKELVKKAI QIGVAYAEKR GVVEFEATDS ASEKLLYIYR LLVHDKIIQP        60
     LPEDQVSQPT IQHKLAIWAS KQP                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page