(data stored in ACNUC7421 zone)

EMBL: AM286690.PE66

AM286690.PE66        Location/Qualifiers
FT   CDS             complement(68748..69449)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0066"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /function="hydrolyses fumarylacetoacetate into fumarate and
FT                   acetoacetate which then join the citric acid cycle"
FT                   /note="fumarylacetoacetate hydrolase family protein)
FT                   identified by match to PFAM protein family HMMPF01557
FT                   InterPro: Fumarylacetoacetate (FAA) hydrolase family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15514"
FT                   /db_xref="GOA:Q0VTE8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE8"
FT                   /inference="protein motif:HMMPFAM:HMMPF01557"
FT                   /protein_id="CAL15514.1"
FT                   /translation="MFDEINEIQVDPDGYQHRWIDGSAMNMPVGKVVCVGRNYADHAKE
FT                   LGNETPDAPILFMKPATALTSLHEPLVLPEGQGPVHHEVEMVVLIGKRIRKETRLDHVR
FT                   FSVAAYGIGLDLTLREVQNQLKEKGHPWERAKAFDGAAPVSGFIDARGISVRQDLGVTL
FT                   ELNDAVKQHGHTGQMLFPTFELLSEISQTFTLEPGDVVFTGTPAGVGPLNSGDKFTARL
FT                   GNIIQVFGSVA"
     MFDEINEIQV DPDGYQHRWI DGSAMNMPVG KVVCVGRNYA DHAKELGNET PDAPILFMKP        60
     ATALTSLHEP LVLPEGQGPV HHEVEMVVLI GKRIRKETRL DHVRFSVAAY GIGLDLTLRE       120
     VQNQLKEKGH PWERAKAFDG AAPVSGFIDA RGISVRQDLG VTLELNDAVK QHGHTGQMLF       180
     PTFELLSEIS QTFTLEPGDV VFTGTPAGVG PLNSGDKFTA RLGNIIQVFG SVA              233
//

If you have problems or comments...

PBIL Back to PBIL home page