(data stored in ACNUC7421 zone)

EMBL: AM286690.PE67

AM286690.PE67        Location/Qualifiers
FT   CDS             complement(69442..70839)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0067"
FT                   /product="oxidoreductase with NAD+ or NADP+ as acceptor"
FT                   /function="works in conjunction with acyl-CoA dehydrogenase
FT                   to catalyze the oxidation of CoA and reduce ubiquinone"
FT                   /EC_number="1.1.1.-"
FT                   /note="oxidoreductase FAD-binding putative identified by
FT                   match to TIGR protein family HMMTIGR01679 InterPro: FAD
FT                   linked oxidase C-terminal"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15515"
FT                   /db_xref="GOA:Q0VTE7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE7"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01679"
FT                   /protein_id="CAL15515.1"
FT                   /translation="MMTALAHAALEQLTDLLGNRCLTDQESAERYGVDWTKVWAPAPCA
FT                   VALPETTEEVQQIVEIANEHGLHLVPSGGRTGLSAGAVAANNELVVAFDRMNTILDFNE
FT                   FDRAVTVQPGVITQQLQEFAEQKGLFYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTR
FT                   DWITGLKVVTGKGELLDLNKGLIKNATGYDFRHLFIGSEGTLGFVVEATVKLAREPKDL
FT                   TALVLGAPGFREVMKILHAFQQDIDLTAFEFFSDKAMAHVLEHGVAKPFDTECPFYCLL
FT                   EFEQLSEQIGDQAMAIFERCVEEGWVLDGVMSQSLQQLDQLWQLRERISESIAPHTPYK
FT                   NDISVTVSKVPDFVEDIDTVVQDAYPDFEIVWFGHIGDGNMHLNILKPADLPKEDFFAK
FT                   CNNVSKWVFEIVQKYNGSISAEHGVGMTKKPYLEYSRSPEEIACMKAVKQVFDPNNVMN
FT                   PGKLFDV"
     MMTALAHAAL EQLTDLLGNR CLTDQESAER YGVDWTKVWA PAPCAVALPE TTEEVQQIVE        60
     IANEHGLHLV PSGGRTGLSA GAVAANNELV VAFDRMNTIL DFNEFDRAVT VQPGVITQQL       120
     QEFAEQKGLF YPVDFASAGS SQIGGNIGTN AGGIKVIRYG MTRDWITGLK VVTGKGELLD       180
     LNKGLIKNAT GYDFRHLFIG SEGTLGFVVE ATVKLAREPK DLTALVLGAP GFREVMKILH       240
     AFQQDIDLTA FEFFSDKAMA HVLEHGVAKP FDTECPFYCL LEFEQLSEQI GDQAMAIFER       300
     CVEEGWVLDG VMSQSLQQLD QLWQLRERIS ESIAPHTPYK NDISVTVSKV PDFVEDIDTV       360
     VQDAYPDFEI VWFGHIGDGN MHLNILKPAD LPKEDFFAKC NNVSKWVFEI VQKYNGSISA       420
     EHGVGMTKKP YLEYSRSPEE IACMKAVKQV FDPNNVMNPG KLFDV                       465
//

If you have problems or comments...

PBIL Back to PBIL home page