(data stored in ACNUC7421 zone)

EMBL: AM286690.PE70

AM286690.PE70        Location/Qualifiers
FT   CDS             73699..74097
FT                   /transl_table=11
FT                   /locus_tag="ABO_0070"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15518"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKU3"
FT                   /protein_id="CAL15518.1"
FT                   /translation="MTFLRPMLAILVALVLAACSASNKGQMEVTEDGEVVTKVHSSNSL
FT                   LSSRISVVDLRQKRVGDLLQVQAVLENDWKFQLDFQYKFKWFDADGFELEPEAQPWRQV
FT                   VMAGRSQNSVQGVSPNPSAVRFEIWVQE"
     MTFLRPMLAI LVALVLAACS ASNKGQMEVT EDGEVVTKVH SSNSLLSSRI SVVDLRQKRV        60
     GDLLQVQAVL ENDWKFQLDF QYKFKWFDAD GFELEPEAQP WRQVVMAGRS QNSVQGVSPN       120
     PSAVRFEIWV QE                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page