(data stored in ACNUC7421 zone)

EMBL: AM286690.PE72

AM286690.PE72        Location/Qualifiers
FT   CDS             74931..76223
FT                   /transl_table=11
FT                   /locus_tag="ABO_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15520"
FT                   /db_xref="GOA:Q0VKU1"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKU1"
FT                   /protein_id="CAL15520.1"
FT                   /translation="MIKRLFSPFFLILLLCSSLSYAMTETVSVSARGYGDNPEQAMTNA
FT                   LVAAVRQGGGVTLAVDPNFRTNVYEWVINQKGDVSTWQGKETSVPEPQLPTLGNIKTYQ
FT                   VQTVKQVNDGIWQAQIQAEILRPKTIGPDRSHLPGIAIATFESAKSSYDLGDIKVPASQ
FT                   VQHQLQDNLTMAFSQSGRYRVLDRTYLADVDEELGVVAQGSIAPEEMARLGQRKGADLL
FT                   LVGTIEDFQIGDSAQAFYGAKMGGYAPYVRVRYRLIDTTTTEILWSDLYEWDKSEAVIR
FT                   EIARQLNIDDRNHPERLADQIYPEIARAIAGDATDVLYPVQVIKVDGEAVFLSQGQGRL
FT                   EKGGIMKVYRPAGEMKDPDTGMTIKLEGEALATLKVSDVRTDYGIARVEGEASPLQVGD
FT                   RVRSDKQAQRSLASPAGQAATPGSSDAPLKW"
     MIKRLFSPFF LILLLCSSLS YAMTETVSVS ARGYGDNPEQ AMTNALVAAV RQGGGVTLAV        60
     DPNFRTNVYE WVINQKGDVS TWQGKETSVP EPQLPTLGNI KTYQVQTVKQ VNDGIWQAQI       120
     QAEILRPKTI GPDRSHLPGI AIATFESAKS SYDLGDIKVP ASQVQHQLQD NLTMAFSQSG       180
     RYRVLDRTYL ADVDEELGVV AQGSIAPEEM ARLGQRKGAD LLLVGTIEDF QIGDSAQAFY       240
     GAKMGGYAPY VRVRYRLIDT TTTEILWSDL YEWDKSEAVI REIARQLNID DRNHPERLAD       300
     QIYPEIARAI AGDATDVLYP VQVIKVDGEA VFLSQGQGRL EKGGIMKVYR PAGEMKDPDT       360
     GMTIKLEGEA LATLKVSDVR TDYGIARVEG EASPLQVGDR VRSDKQAQRS LASPAGQAAT       420
     PGSSDAPLKW                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page