(data stored in ACNUC7421 zone)

EMBL: AM286690.PE74

AM286690.PE74        Location/Qualifiers
FT   CDS             complement(77735..78337)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0074"
FT                   /product="CBS domain protein"
FT                   /function="CBS"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15522"
FT                   /db_xref="GOA:Q0VKT9"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKT9"
FT                   /protein_id="CAL15522.1"
FT                   /translation="MSKQSDQLRQQLVGGVLRQLHLEAMSERFNPRVVLALFNLVNGGL
FT                   SIALIASVALVTQQAFIFPSLGASAFLLFHLPLAEAASPRNVLCGHLIGALCGWASLWV
FT                   CGLHDAPAAFITGVEWPRVVAAGLSLGMASALMILFRVAHPPAAATALIVSLGLMHELQ
FT                   QLPVLLSAVALLVAQAFVINRLAGIPYPLWKTPQPNT"
     MSKQSDQLRQ QLVGGVLRQL HLEAMSERFN PRVVLALFNL VNGGLSIALI ASVALVTQQA        60
     FIFPSLGASA FLLFHLPLAE AASPRNVLCG HLIGALCGWA SLWVCGLHDA PAAFITGVEW       120
     PRVVAAGLSL GMASALMILF RVAHPPAAAT ALIVSLGLMH ELQQLPVLLS AVALLVAQAF       180
     VINRLAGIPY PLWKTPQPNT                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page