(data stored in ACNUC7421 zone)

EMBL: AM286690.PE78

AM286690.PE78        Location/Qualifiers
FT   CDS             complement(82763..83209)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0078"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15526"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKT5"
FT                   /protein_id="CAL15526.1"
FT                   /translation="MPDVIGATTMQRIEIHKTFPFSVDKLFNFLSVHENLELIFAPAKI
FT                   KRIKDGQDSPNGVGSTRKMQILIAPPFEETVTKIVPNERIEYAITKGSPLKHHKGVMRF
FT                   SEAANGGSKLDYTIEFEGKLPLIGPIIKAGLGQAIGRGLNKLKL"
     MPDVIGATTM QRIEIHKTFP FSVDKLFNFL SVHENLELIF APAKIKRIKD GQDSPNGVGS        60
     TRKMQILIAP PFEETVTKIV PNERIEYAIT KGSPLKHHKG VMRFSEAANG GSKLDYTIEF       120
     EGKLPLIGPI IKAGLGQAIG RGLNKLKL                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page