(data stored in ACNUC7421 zone)

EMBL: AM286690.PE82

AM286690.PE82        Location/Qualifiers
FT   CDS             87194..87451
FT                   /transl_table=11
FT                   /locus_tag="ABO_0082"
FT                   /product="putative truncated transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="putative truncated transposase OrfA identified by
FT                   match to PFAM protein family HMMPF04218"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15530"
FT                   /db_xref="GOA:Q0VTL3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL3"
FT                   /inference="protein motif:HMMPFAM:HMMPF04218"
FT                   /protein_id="CAL15530.1"
FT                   /translation="MTRKRRSFTPEFKQEAAILVLDQGYTISQVSVSLGVVESALRRRV
FT                   KQLEAERHGVTPKGKALPLNSGVFRSWRPAAIGWNGRRAY"
     MTRKRRSFTP EFKQEAAILV LDQGYTISQV SVSLGVVESA LRRRVKQLEA ERHGVTPKGK        60
     ALPLNSGVFR SWRPAAIGWN GRRAY                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page