(data stored in ACNUC7421 zone)

EMBL: AM286690.PE83

AM286690.PE83        Location/Qualifiers
FT   CDS             87866..88330
FT                   /transl_table=11
FT                   /locus_tag="ABO_0083"
FT                   /product="transposase, putative"
FT                   /note="transposase identified by match to PFAM protein
FT                   family HMMPF00665;putative InterPro: Integrase catalytic
FT                   core"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15531"
FT                   /db_xref="GOA:Q0VTL2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL2"
FT                   /inference="protein motif:HMMPFAM:HMMPF00665"
FT                   /protein_id="CAL15531.1"
FT                   /translation="MVRRYHLYLAVVLDLFARRVVGWAVSSHPDADLVVKALDHAWGQR
FT                   GQPDKVMLDSDQGSQYASRMFRQRLWRYRMQQSMSRRGNCWVNAPMERLFRSLKSEWVP
FT                   TMGYRDLPEAKKDIGDYLMGYYNHHRPHSYNGGIASAMAEEKPKSLSGIS"
     MVRRYHLYLA VVLDLFARRV VGWAVSSHPD ADLVVKALDH AWGQRGQPDK VMLDSDQGSQ        60
     YASRMFRQRL WRYRMQQSMS RRGNCWVNAP MERLFRSLKS EWVPTMGYRD LPEAKKDIGD       120
     YLMGYYNHHR PHSYNGGIAS AMAEEKPKSL SGIS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page