(data stored in ACNUC7421 zone)

EMBL: AM286690.PE85

AM286690.PE85        Location/Qualifiers
FT   CDS             complement(89667..91277)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0085"
FT                   /product="GMC oxidoreductase family protein, putative"
FT                   /note="identified by sequence similarity; identified by
FT                   match to PFAM protein family HMMPF00732; putative InterPro:
FT                   Glucose-methanol-choline (GMC) oxidoreductase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15533"
FT                   /db_xref="GOA:Q0VTL0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL0"
FT                   /inference="protein motif:HMMPFAM:HMMPF00732"
FT                   /protein_id="CAL15533.1"
FT                   /translation="MQDLTTLTINVKDPWKNPANGWDVIDGRTITDNRTLEADVIIVGT
FT                   GAGGGVSAEILSQRGLKVILVEAGKLKSSDDFKLDEGKAYRDLYQEGALRATKDAGMTV
FT                   MQGRTVGGTTVVNWTSSFRTPQKTLQYWHDEFGVQGLSQAQMAPWFQQMEDRLNIEKWA
FT                   MPPNANNDILKRGCDDKGWHSAIIPRNVSGCWNIGYCGMGCPTNAKQSMLVTTIPSALD
FT                   HGSTLIYSAQADTLIIEGDSVTGVRVRPLNDDKKPTGATVTLKAKTVIAAGGGIQSPAL
FT                   LMRSDAPDPNGLVGKRTFLHPTTFVFGLYDKEIAPYYGAPQSMYSDEFTFKHGVDGPAG
FT                   YKMEMMPMHPGLSGALIGGFGEQAREEIERLPNLATAIALIRDGFHEDNQGGTVELRDN
FT                   GEPLLDYPVNDYLLEGAKRSHLTMLEMQFAAGAKEVRPSHAHAGYYKSWKAAREGVAQL
FT                   DYAPVVTALGSAHVMGGLTMGADESRCTVNSDGSYKHLNGLYIIDGSVFPTSIGANPQL
FT                   SIYGLSARNASALADKLKG"
     MQDLTTLTIN VKDPWKNPAN GWDVIDGRTI TDNRTLEADV IIVGTGAGGG VSAEILSQRG        60
     LKVILVEAGK LKSSDDFKLD EGKAYRDLYQ EGALRATKDA GMTVMQGRTV GGTTVVNWTS       120
     SFRTPQKTLQ YWHDEFGVQG LSQAQMAPWF QQMEDRLNIE KWAMPPNANN DILKRGCDDK       180
     GWHSAIIPRN VSGCWNIGYC GMGCPTNAKQ SMLVTTIPSA LDHGSTLIYS AQADTLIIEG       240
     DSVTGVRVRP LNDDKKPTGA TVTLKAKTVI AAGGGIQSPA LLMRSDAPDP NGLVGKRTFL       300
     HPTTFVFGLY DKEIAPYYGA PQSMYSDEFT FKHGVDGPAG YKMEMMPMHP GLSGALIGGF       360
     GEQAREEIER LPNLATAIAL IRDGFHEDNQ GGTVELRDNG EPLLDYPVND YLLEGAKRSH       420
     LTMLEMQFAA GAKEVRPSHA HAGYYKSWKA AREGVAQLDY APVVTALGSA HVMGGLTMGA       480
     DESRCTVNSD GSYKHLNGLY IIDGSVFPTS IGANPQLSIY GLSARNASAL ADKLKG           536
//

If you have problems or comments...

PBIL Back to PBIL home page