(data stored in ACNUC7421 zone)

EMBL: AM286690.PE86

AM286690.PE86        Location/Qualifiers
FT   CDS             complement(91337..91870)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15534"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK9"
FT                   /protein_id="CAL15534.1"
FT                   /translation="MDQEINRRGFLKLSAAGSAVLATGSGLALLTGCSSNDGPATGYKH
FT                   FRQQDVDLLTPLVGAVLGPALTNVGASAEDGMKAFDDLLEGGMPGTRAALFQVLDLMQL
FT                   GAARWYITGTWASFADQSEQEIKQTLTEWSASERSLSRMAFKGLTQPIHMAWYVKPAAA
FT                   RSTGYPGPPKKIIA"
     MDQEINRRGF LKLSAAGSAV LATGSGLALL TGCSSNDGPA TGYKHFRQQD VDLLTPLVGA        60
     VLGPALTNVG ASAEDGMKAF DDLLEGGMPG TRAALFQVLD LMQLGAARWY ITGTWASFAD       120
     QSEQEIKQTL TEWSASERSL SRMAFKGLTQ PIHMAWYVKP AAARSTGYPG PPKKIIA          177
//

If you have problems or comments...

PBIL Back to PBIL home page