(data stored in ACNUC7421 zone)

EMBL: AM286690.PE89

AM286690.PE89        Location/Qualifiers
FT   CDS             complement(94310..95479)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0089"
FT                   /product="hydrolase, alpha/beta fold family, putative"
FT                   /function="Predicted hydrolase of the alpha"
FT                   /note="(hydrolase alpha/beta fold family) identified by
FT                   match to TIGR protein family HMMTIGR01250 InterPro:
FT                   Esterase/lipase/thioesterase family active site enzymes of
FT                   the alpha/beta fold enzymes operate on substrates with
FT                   different chemical composition in various biological
FT                   contexts"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15538"
FT                   /db_xref="GOA:Q0VTK5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK5"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01250"
FT                   /protein_id="CAL15538.1"
FT                   /translation="MVACASTQLYKLTYMKVLIIKKAARHGISITNRCQREKQKATIPA
FT                   PRPRRDFANPMDETLPMGEIVQSAFRPPLWLRNPHLQTLWGPMGRTLPEVTRRTERLNL
FT                   KDGDYLLLDWAGPQSQPGQLTVMLLHGLSGCSDSHYMRGIQKVLAEAGIRSVAINSRGA
FT                   KKPNDTALCYHAGEVDDVDAVIDHVFHENPTGHRIAIGVSLGGSRLLNWLAHRDNNHLS
FT                   AVATICAPLRLDICANRLDQGLSKLYRQHLLKNLLTNFERQKIHLDKVNPPEAKRLHRL
FT                   NMNSIRSFWRYDDQIIAPLYGFRSAWHYYAQCSAGPKLLQIRTPTLMLQNRDDPFMTPQ
FT                   TLPRQEELGPAVTLEVSDYGGHVGFVGYKSQRYWLEQRLLAFVQGFGIR"
     MVACASTQLY KLTYMKVLII KKAARHGISI TNRCQREKQK ATIPAPRPRR DFANPMDETL        60
     PMGEIVQSAF RPPLWLRNPH LQTLWGPMGR TLPEVTRRTE RLNLKDGDYL LLDWAGPQSQ       120
     PGQLTVMLLH GLSGCSDSHY MRGIQKVLAE AGIRSVAINS RGAKKPNDTA LCYHAGEVDD       180
     VDAVIDHVFH ENPTGHRIAI GVSLGGSRLL NWLAHRDNNH LSAVATICAP LRLDICANRL       240
     DQGLSKLYRQ HLLKNLLTNF ERQKIHLDKV NPPEAKRLHR LNMNSIRSFW RYDDQIIAPL       300
     YGFRSAWHYY AQCSAGPKLL QIRTPTLMLQ NRDDPFMTPQ TLPRQEELGP AVTLEVSDYG       360
     GHVGFVGYKS QRYWLEQRLL AFVQGFGIR                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page