(data stored in ACNUC7421 zone)

EMBL: AM286690.PE91

AM286690.PE91        Location/Qualifiers
FT   CDS             96114..96530
FT                   /transl_table=11
FT                   /locus_tag="ABO_0091"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15539"
FT                   /db_xref="GOA:Q0VTK4"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK4"
FT                   /protein_id="CAL15539.1"
FT                   /translation="MATKGKARPRRSRRRTGSKAVAASGIIAALMALAVFALVLGIYAR
FT                   HNRLLPYLAGVYAVPSVLVFGLYGWDKRVAVRGGSRTSEQSLHLLALAGGWPGAMLARS
FT                   LFRHKTRKQPFTGIFWCTVLFNVGTVSVLLGEVG"
     MATKGKARPR RSRRRTGSKA VAASGIIAAL MALAVFALVL GIYARHNRLL PYLAGVYAVP        60
     SVLVFGLYGW DKRVAVRGGS RTSEQSLHLL ALAGGWPGAM LARSLFRHKT RKQPFTGIFW       120
     CTVLFNVGTV SVLLGEVG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page