(data stored in ACNUC7421 zone)

EMBL: AM286690.PE92

AM286690.PE92        Location/Qualifiers
FT   CDS             96622..97491
FT                   /transl_table=11
FT                   /locus_tag="ABO_0092"
FT                   /product="membrane protein, putative"
FT                   /function="may function as a membrane-associated protein
FT                   kinase that phosphorylates glpr in response to
FT                   environmental signals"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15540"
FT                   /db_xref="GOA:Q0VTK3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK3"
FT                   /protein_id="CAL15540.1"
FT                   /translation="MGGLLMSAKRSLVLTALAMLAFAANSVLCRLALREGAIDAASFTA
FT                   VRLLSGALMLALILLLRDRQVKAMVTQGNHGSALALFVYAAGFSLAYVALATGTGALLL
FT                   FGAVQATMVGVGLYRGERLARAQWLGLALALSGLVALMLPGATAPPLAAAIVMLVAGAA
FT                   WGVYSLRGKGAADATAVTAGNFLRALIWLLPLALFAWPSQWPKVSGLLYAALSGALASG
FT                   AGYATWYLALRGLASSTAATVQLSVPVLAALAGVLWMDEALTLRLVLASAAILGGITLV
FT                   IRRVSSAK"
     MGGLLMSAKR SLVLTALAML AFAANSVLCR LALREGAIDA ASFTAVRLLS GALMLALILL        60
     LRDRQVKAMV TQGNHGSALA LFVYAAGFSL AYVALATGTG ALLLFGAVQA TMVGVGLYRG       120
     ERLARAQWLG LALALSGLVA LMLPGATAPP LAAAIVMLVA GAAWGVYSLR GKGAADATAV       180
     TAGNFLRALI WLLPLALFAW PSQWPKVSGL LYAALSGALA SGAGYATWYL ALRGLASSTA       240
     ATVQLSVPVL AALAGVLWMD EALTLRLVLA SAAILGGITL VIRRVSSAK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page