(data stored in ACNUC7421 zone)

EMBL: AM286690.PE94

AM286690.PE94        Location/Qualifiers
FT   CDS             complement(98144..98815)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15542"
FT                   /db_xref="GOA:Q0VTK1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK1"
FT                   /protein_id="CAL15542.1"
FT                   /translation="MGVFLLTRLPPWVEVGAFLLAFLAGSVNAVGLLGFSHQSVSHLTG
FT                   TSSLLGLALAELALSNVLHLLFTLISFLAGAILSGLLITSTALKLGRHYGFSLLIEAAL
FT                   LILAMLFLQRGNDIGVYLASMACGLQNAMVTTYSGSIIRTTHLSGIFTDLGIMLGNRLR
FT                   GIPLNGRRLLLFLLLISGFICGGVIGTLLFRLLHFSALIAPATLAALLAVIYWGYSRQH
FT                   R"
     MGVFLLTRLP PWVEVGAFLL AFLAGSVNAV GLLGFSHQSV SHLTGTSSLL GLALAELALS        60
     NVLHLLFTLI SFLAGAILSG LLITSTALKL GRHYGFSLLI EAALLILAML FLQRGNDIGV       120
     YLASMACGLQ NAMVTTYSGS IIRTTHLSGI FTDLGIMLGN RLRGIPLNGR RLLLFLLLIS       180
     GFICGGVIGT LLFRLLHFSA LIAPATLAAL LAVIYWGYSR QHR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page