(data stored in ACNUC7421 zone)

EMBL: AM286690.PEPA

AM286690.PEPA        Location/Qualifiers
FT   CDS             complement(544097..545566)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="ABO_0495"
FT                   /product="leucyl aminopeptidase"
FT                   /function="presumably involved in the processing and
FT                   regular turnover of intracellular proteins. catalyzes the
FT                   removal of unsubstituted N-terminal amino acids from
FT                   various peptides. release of an N-terminal amino acid,
FT                   xaa-|- xbb-, in which xaa is preferably leu, but may be
FT                   other amino acids including pro although not arg or lys,
FT                   and xbb may be pro."
FT                   /EC_number="3.4.11.1"
FT                   /note="(leucyl aminopeptidase, leucine aminopeptidase,
FT                   cytosol aminopeptidase) identified by sequence similarity;
FT                   putative identified by match to PFAM protein family
FT                   HMMPF00883 InterPro: Cytosol aminopeptidase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15943"
FT                   /db_xref="GOA:Q0VSA5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSA5"
FT                   /inference="protein motif:HMMPFAM:HMMPF00883"
FT                   /protein_id="CAL15943.1"
FT                   /translation="MDFAVSNRPLEKSKADALVVLLGKKNDLPQALPSATREQISQFTK
FT                   AGDFNASKGQLVWLHAPQDLNADRLLLVGTGDSPLSDQGWLSLVHKATKTLASSPVKQA
FT                   MWLLDDTHTQTLEWQVREGSRVVEESTYRFDNYRSKPAPASNLAKLTFWHAEKDTTLTK
FT                   AHKTGKAVGLGVNVARDLGNLPPNDCYPEYLSGVARDLGKEYEKLTVKVLSQAQAEKMG
FT                   MGAFHAVAKGSERQGQIIVMEYKGAKPTKQGPVALVGKGITFDTGGISLKPGATMDEMK
FT                   YDMGGAASVFGSVKTVCELDLPIHLVAVVAAAENMPDGRAARPGDIVKTLSGQTVEILN
FT                   TDAEGRLVLCDALTYVQQKHKPHTVIDIATLTGACVVALGAHAQAVYSNDDDLSEALLA
FT                   AGKETGDRGWPMPLWDEYQGQLDSPFADMQNIGGPKAGSITAACFLSRFTKEVKWAHLD
FT                   IAGTAWISGGMSKGATGRPVPMLTRYLMDNA"
     MDFAVSNRPL EKSKADALVV LLGKKNDLPQ ALPSATREQI SQFTKAGDFN ASKGQLVWLH        60
     APQDLNADRL LLVGTGDSPL SDQGWLSLVH KATKTLASSP VKQAMWLLDD THTQTLEWQV       120
     REGSRVVEES TYRFDNYRSK PAPASNLAKL TFWHAEKDTT LTKAHKTGKA VGLGVNVARD       180
     LGNLPPNDCY PEYLSGVARD LGKEYEKLTV KVLSQAQAEK MGMGAFHAVA KGSERQGQII       240
     VMEYKGAKPT KQGPVALVGK GITFDTGGIS LKPGATMDEM KYDMGGAASV FGSVKTVCEL       300
     DLPIHLVAVV AAAENMPDGR AARPGDIVKT LSGQTVEILN TDAEGRLVLC DALTYVQQKH       360
     KPHTVIDIAT LTGACVVALG AHAQAVYSND DDLSEALLAA GKETGDRGWP MPLWDEYQGQ       420
     LDSPFADMQN IGGPKAGSIT AACFLSRFTK EVKWAHLDIA GTAWISGGMS KGATGRPVPM       480
     LTRYLMDNA                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page