(data stored in ACNUC7421 zone)

EMBL: AM286690.PETA

AM286690.PETA        Location/Qualifiers
FT   CDS             636314..636901
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="ABO_0578"
FT                   /product="ubiquinol--cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /function="component of the ubiquinol-cytochrome c
FT                   reductase complex (complex iii or cytochrome b-c1 complex),
FT                   which is a respiratory chain that generates an
FT                   electrochemical potential coupled to ATP synthesis. qh(2) +
FT                   2 ferricytochrome c = q + 2 ferrocytochrome c."
FT                   /EC_number="1.10.2.2"
FT                   /note="(ubiquinol--cytochrome c reductase
FT                   iron-sulfursubunit) identified by match to PFAM protein
FT                   family HMMPF00355 InterPro: Rieske iron-sulfur protein
FT                   2Fe-2S subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16026"
FT                   /db_xref="GOA:Q0VS22"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS22"
FT                   /inference="protein motif:HMMPFAM:HMMPF00355"
FT                   /protein_id="CAL16026.1"
FT                   /translation="MSNDGVNSSRRTFLIGLTSAIGAAGAVGVAVPFVKSWQPSAKAKN
FT                   AGAPVKVDIGRLEAGQRVVEEWRGQPIWVVRRTENMLDTLPQLDEKLRDPASEVDQQPD
FT                   YARNEWRSIKKEYLVLVGTCTHLGCSPLFEEQPTVELEFGGFFCPCHGSKFDFAGRVYK
FT                   GVPAPTNLVVPPHSYLSEAVVIVGSEEGETKA"
     MSNDGVNSSR RTFLIGLTSA IGAAGAVGVA VPFVKSWQPS AKAKNAGAPV KVDIGRLEAG        60
     QRVVEEWRGQ PIWVVRRTEN MLDTLPQLDE KLRDPASEVD QQPDYARNEW RSIKKEYLVL       120
     VGTCTHLGCS PLFEEQPTVE LEFGGFFCPC HGSKFDFAGR VYKGVPAPTN LVVPPHSYLS       180
     EAVVIVGSEE GETKA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page