(data stored in ACNUC7421 zone)

EMBL: AM286690.PFKB

AM286690.PFKB        Location/Qualifiers
FT   CDS             complement(385842..386846)
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="ABO_0350"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /function="phosphorylates sugars in the presence of ATP and
FT                   magnesium"
FT                   /EC_number="2.7.1.4"
FT                   /note="(carbohydrate kinase, PfkB family) identified by
FT                   sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15798"
FT                   /db_xref="GOA:Q0VSQ0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ0"
FT                   /protein_id="CAL15798.1"
FT                   /translation="MTKKYDVYALGNALVDTEIEVSDAFLQRMEVDKGLMTLVDEARQA
FT                   ELLEALTDEAEPRKQTSGGSACNTVVATRYFGGNSYYACKVADDTTGSIFVDDLTTAGV
FT                   DTNMNGPRDSGVSGKCLVMLTPDAERTMNTHLGISSQVSNAELDEAAIAASHYVYLEGY
FT                   LVSGDSSRAAAIKLRQLAEKHGIKTSLTFSDPAMVQFFKDGLNEMLGERVDLLFCNEAE
FT                   ATSFTGTDNVDTALAALKSRCGSAVITLGAEGALAWDGEHTHRIDPVPVKAIDTNGAGD
FT                   MFAGAFLYAITHGHDFVAAGKLASAASARLVSEFGPRLPAEVHLQLRKATLGE"
     MTKKYDVYAL GNALVDTEIE VSDAFLQRME VDKGLMTLVD EARQAELLEA LTDEAEPRKQ        60
     TSGGSACNTV VATRYFGGNS YYACKVADDT TGSIFVDDLT TAGVDTNMNG PRDSGVSGKC       120
     LVMLTPDAER TMNTHLGISS QVSNAELDEA AIAASHYVYL EGYLVSGDSS RAAAIKLRQL       180
     AEKHGIKTSL TFSDPAMVQF FKDGLNEMLG ERVDLLFCNE AEATSFTGTD NVDTALAALK       240
     SRCGSAVITL GAEGALAWDG EHTHRIDPVP VKAIDTNGAG DMFAGAFLYA ITHGHDFVAA       300
     GKLASAASAR LVSEFGPRLP AEVHLQLRKA TLGE                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page