(data stored in ACNUC7421 zone)

EMBL: AM286690.PHAB

AM286690.PHAB        Location/Qualifiers
FT   CDS             complement(578775..579587)
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="ABO_0526"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /function="catalyze the reversible hydration of alpha,
FT                   beta-unsaturated enoyl-CoA substrates to the corresponding
FT                   beta-hydroxyacyl-CoA products"
FT                   /EC_number="4.2.1.17"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Enoyl-CoA hydratase/isomerase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15974"
FT                   /db_xref="GOA:Q0VS74"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS74"
FT                   /protein_id="CAL15974.1"
FT                   /translation="MSLIRDRVKLEKKDGIAYVTLSRADKYNGLDFPMMEGLVETARLI
FT                   RKDRQLRAVILQGEGKAFCAGLDFGTVMKQPVKLLRSFTKYGIKKTNLFQDVCWCWREL
FT                   PIPVIAVLHGYCYGGGMQIALAADFRITTADCEMSIMEIKWGMIPDMTGTVTLRELVPM
FT                   DVAKELTMTGRLFSGDEAKTMNLVTRVAADPLEEAEKLAQAIIGRSPDAISASKALFQQ
FT                   SWNVPEAQAFDVESKLQFKLLRSKNQRRAMQANMKKETPQFGPRERDY"
     MSLIRDRVKL EKKDGIAYVT LSRADKYNGL DFPMMEGLVE TARLIRKDRQ LRAVILQGEG        60
     KAFCAGLDFG TVMKQPVKLL RSFTKYGIKK TNLFQDVCWC WRELPIPVIA VLHGYCYGGG       120
     MQIALAADFR ITTADCEMSI MEIKWGMIPD MTGTVTLREL VPMDVAKELT MTGRLFSGDE       180
     AKTMNLVTRV AADPLEEAEK LAQAIIGRSP DAISASKALF QQSWNVPEAQ AFDVESKLQF       240
     KLLRSKNQRR AMQANMKKET PQFGPRERDY                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page