(data stored in ACNUC7421 zone)

EMBL: AM286690.PHOR

AM286690.PHOR        Location/Qualifiers
FT   CDS             174960..176270
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ABO_0167"
FT                   /product="Phosphate regulon sensor protein PhoR"
FT                   /function="Member of the two-component regulatory system
FT                   phoR/phoB involved in the phosphate regulon genes
FT                   expression. phoR may function as a membrane-associated
FT                   protein kinase that phosphorylates phoB in response to
FT                   environmental signals."
FT                   /EC_number="2.7.3.-"
FT                   /note="(sensory box histidine kinase PhoR) identified by
FT                   sequence similarity; putative InterPro: Histidine kinase
FT                   C-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15615"
FT                   /db_xref="GOA:Q0VTA5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA5"
FT                   /protein_id="CAL15615.1"
FT                   /translation="MKASLAKEVNRIAGLIFLAALAALAVGHTWPLLVGLGGYIIWSTR
FT                   QLFALYSWLVRDDHTEPPDSIGLWGEFYTRLEHLFQKERRAQENLQGIIHRAQQSVNAL
FT                   DDVVILIDQHGYLEYWNHAAERAMGFNASQDLGQPLTNLIRHPRFTGYLSKGDFQDPLE
FT                   IPSPVNDNRILQFRVTEFGIGEQLLIARDVTRLHHLEQMRKDFVANVSHELKTPLTVLK
FT                   GYLETLLDTLPEEQARLRRALMQMDNQSNRMEALVADLLLLARLEGTEADSVRQAVPVH
FT                   GMLNRMKENALAIGSDKDHQIELDVPLDARLIANPAELESAFGNLITNAVKYTPANGTI
FT                   RIRWWQDSCGAHFSVTDNGIGIDPAHIPRLTERFYRPDNSRVTETGGTGLGLAIVKHVM
FT                   IRHDGRLEIVSELSKGSTFTCHFPAERLVSKPTAVAG"
     MKASLAKEVN RIAGLIFLAA LAALAVGHTW PLLVGLGGYI IWSTRQLFAL YSWLVRDDHT        60
     EPPDSIGLWG EFYTRLEHLF QKERRAQENL QGIIHRAQQS VNALDDVVIL IDQHGYLEYW       120
     NHAAERAMGF NASQDLGQPL TNLIRHPRFT GYLSKGDFQD PLEIPSPVND NRILQFRVTE       180
     FGIGEQLLIA RDVTRLHHLE QMRKDFVANV SHELKTPLTV LKGYLETLLD TLPEEQARLR       240
     RALMQMDNQS NRMEALVADL LLLARLEGTE ADSVRQAVPV HGMLNRMKEN ALAIGSDKDH       300
     QIELDVPLDA RLIANPAELE SAFGNLITNA VKYTPANGTI RIRWWQDSCG AHFSVTDNGI       360
     GIDPAHIPRL TERFYRPDNS RVTETGGTGL GLAIVKHVMI RHDGRLEIVS ELSKGSTFTC       420
     HFPAERLVSK PTAVAG                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page