(data stored in ACNUC7421 zone)

EMBL: AM286690.PILG

AM286690.PILG        Location/Qualifiers
FT   CDS             complement(117480..117863)
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="ABO_0109"
FT                   /product="type IV pili response regulator PilG"
FT                   /function="response regulator involved in signal
FT                   trasduction for pilus-biosynthesis"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Response regulator receiver domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15557"
FT                   /db_xref="GOA:Q0VTI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTI6"
FT                   /protein_id="CAL15557.1"
FT                   /translation="MTDNFQDLKVMVIDDSKTIRRTAETLLKKAGCEVITATDGFDALA
FT                   KIADSKPHIIFVDIMMPRLDGYQTCALIKNNSAFKATPVIMLSSKDGLFDKAKGRIVGS
FT                   DEYLTKPFSKDELLGAIRQHING"
     MTDNFQDLKV MVIDDSKTIR RTAETLLKKA GCEVITATDG FDALAKIADS KPHIIFVDIM        60
     MPRLDGYQTC ALIKNNSAFK ATPVIMLSSK DGLFDKAKGR IVGSDEYLTK PFSKDELLGA       120
     IRQHING                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page