(data stored in ACNUC7421 zone)

EMBL: AM286690.PILH

AM286690.PILH        Location/Qualifiers
FT   CDS             complement(117079..117447)
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="ABO_0108"
FT                   /product="type IV pili response regulator PilH"
FT                   /function="FOG response regulatory protein for twitching
FT                   motility"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Response regulator receiver domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15556"
FT                   /db_xref="GOA:Q0VTI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTI7"
FT                   /protein_id="CAL15556.1"
FT                   /translation="MARILIVDDSPTETYKLREILERHGHEVIEAANGADGVATARSEL
FT                   PELVLMDVVMPGLNGFQATRQLTKGADTAHIPIVIVTTKDQETDRVWGKRQGARDYLTK
FT                   PVDEDVLLQTVNRMLDDA"
     MARILIVDDS PTETYKLREI LERHGHEVIE AANGADGVAT ARSELPELVL MDVVMPGLNG        60
     FQATRQLTKG ADTAHIPIVI VTTKDQETDR VWGKRQGARD YLTKPVDEDV LLQTVNRMLD       120
     DA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page