(data stored in ACNUC7421 zone)

EMBL: AM286690.PROB

AM286690.PROB        Location/Qualifiers
FT   CDS             494452..495582
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ABO_0455"
FT                   /product="glutamate 5-kinase"
FT                   /function="catalyzes the transfer of a phosphate group to
FT                   glutamate to form glutamate 5-phosphate which rapidly
FT                   cyclizes to 5-oxoproline. ATP + L-glutamate = ADP +
FT                   L-glutamate 5-phosphate."
FT                   /EC_number="2.7.2.11"
FT                   /note="(glutamate 5-kinase, gamma-glutamyl kinase)
FT                   identified by sequence similarity; putative identified by
FT                   match to PFAM protein family HMMPF00696 InterPro:
FT                   Aspartokinase superfamily"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15903"
FT                   /db_xref="GOA:Q0VSE5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSE5"
FT                   /inference="protein motif:HMMPFAM:HMMPF00696"
FT                   /protein_id="CAL15903.1"
FT                   /translation="MADRQRWVIKIGSALLTNDGKGLDCALMQTWVDRMVALRERGIEV
FT                   VIVSSGAVAEGMTRLGWSARPDSVHELQAAAAVGQMGLVQAWETRFQQHQLHTAQVLLT
FT                   HDDLSDRKRYLNARSTLLTLLGFGVVPVVNENDTVVTDEIRFGDNDTLAALVANLVEAD
FT                   RLLILTDQEGLFDADPRSNADANLIREARASDPAIVRVAGGGGLLGRGGMATKVRAGKL
FT                   AARSGAITTIASGRSPEVLIELADGQGPGTTLLPDTTPMNARKQWLAGHLQMRGRLVLD
FT                   AGAVVRLREGGSSLLPVGVVDVFGQFSRGEMVACEDERGERVGCGLVNYDAADARRICR
FT                   KKSAEIAGVLGFMNEEELIHRDNLVLMEAGSRVSGA"
     MADRQRWVIK IGSALLTNDG KGLDCALMQT WVDRMVALRE RGIEVVIVSS GAVAEGMTRL        60
     GWSARPDSVH ELQAAAAVGQ MGLVQAWETR FQQHQLHTAQ VLLTHDDLSD RKRYLNARST       120
     LLTLLGFGVV PVVNENDTVV TDEIRFGDND TLAALVANLV EADRLLILTD QEGLFDADPR       180
     SNADANLIRE ARASDPAIVR VAGGGGLLGR GGMATKVRAG KLAARSGAIT TIASGRSPEV       240
     LIELADGQGP GTTLLPDTTP MNARKQWLAG HLQMRGRLVL DAGAVVRLRE GGSSLLPVGV       300
     VDVFGQFSRG EMVACEDERG ERVGCGLVNY DAADARRICR KKSAEIAGVL GFMNEEELIH       360
     RDNLVLMEAG SRVSGA                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page