(data stored in ACNUC7421 zone)

EMBL: AM286690.PURE

AM286690.PURE        Location/Qualifiers
FT   CDS             180933..181424
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ABO_0171"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /function="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="(phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit) identified by match to PFAM protein family
FT                   HMMPF00731 InterPro:
FT                   1-(5-Phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15619"
FT                   /db_xref="GOA:Q0VTA1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA1"
FT                   /inference="protein motif:HMMPFAM:HMMPF00731"
FT                   /protein_id="CAL15619.1"
FT                   /translation="MSTPVAVVMGSQSDWETMKEACDALTHFNVGWKAEVVSAHRTPQR
FT                   MYDFAKSAHENGYKVIIAGAGGAAHLPGMIASLTPLPVLGVPVKSRTLSGWDSLLSIVQ
FT                   MPKGVAVGTLAIGAAGAWNAGLLASQMLATENPALLQAIADWKATRADEVLANAELGQG
FT                   "
     MSTPVAVVMG SQSDWETMKE ACDALTHFNV GWKAEVVSAH RTPQRMYDFA KSAHENGYKV        60
     IIAGAGGAAH LPGMIASLTP LPVLGVPVKS RTLSGWDSLL SIVQMPKGVA VGTLAIGAAG       120
     AWNAGLLASQ MLATENPALL QAIADWKATR ADEVLANAEL GQG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page