(data stored in ACNUC7421 zone)

EMBL: AM286690.PURK

AM286690.PURK        Location/Qualifiers
FT   CDS             181469..182575
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="ABO_0172"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /function="Phosphoribosylaminoimidazole carboxylase (NCAIR
FT                   synthetase)"
FT                   /EC_number="4.1.1.21"
FT                   /note="(phosphoribosylaminoimidazole carboxylase
FT                   ATPasesubunit) identified by match to TIGR protein family
FT                   HMMTIGR01142 InterPro: ATP-grasp domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15620"
FT                   /db_xref="GOA:Q0VTA0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA0"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01142"
FT                   /protein_id="CAL15620.1"
FT                   /translation="MNRVLVLGGGQLGLMMAEAAARLGLVVDRYDPERALLLPGTSDLA
FT                   VPISWEECQERYPVITVEREAFPETGFSAELAQSDRCVARGALQVIPDRFTQKTMLDKL
FT                   GIPTAPWVMLDQAEDLPRAVADFGGVVVKARSGGYDGRGTWIVGEGGDLSAVPAVELAG
FT                   KAIVEQKIPFRRELSIVGARSITGETLFYPLTRNWHVDGILRLSLAPANACSDLQAPAE
FT                   IMLKCIMEELDYAGVMAVEFFEVDGQLMVNEIAPRVHNSGHWTHEGADWSQFDLHVHAL
FT                   AGVPLHALNVHGSSAMVNLIGTPFENAWLQHPGVVHWYGKSVRPGRKVGHANLAASSLD
FT                   DLRQGLDAWADVLPEGYQQVLDSERALG"
     MNRVLVLGGG QLGLMMAEAA ARLGLVVDRY DPERALLLPG TSDLAVPISW EECQERYPVI        60
     TVEREAFPET GFSAELAQSD RCVARGALQV IPDRFTQKTM LDKLGIPTAP WVMLDQAEDL       120
     PRAVADFGGV VVKARSGGYD GRGTWIVGEG GDLSAVPAVE LAGKAIVEQK IPFRRELSIV       180
     GARSITGETL FYPLTRNWHV DGILRLSLAP ANACSDLQAP AEIMLKCIME ELDYAGVMAV       240
     EFFEVDGQLM VNEIAPRVHN SGHWTHEGAD WSQFDLHVHA LAGVPLHALN VHGSSAMVNL       300
     IGTPFENAWL QHPGVVHWYG KSVRPGRKVG HANLAASSLD DLRQGLDAWA DVLPEGYQQV       360
     LDSERALG                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page