(data stored in ACNUC7421 zone)

EMBL: AM286690.PYRC-2

AM286690.PYRC-2      Location/Qualifiers
FT   CDS             complement(35544..36875)
FT                   /transl_table=11
FT                   /gene="pyrC-2"
FT                   /locus_tag="ABO_0034"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /function="Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Dihydroorotase multifunctional complex type"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15482"
FT                   /db_xref="GOA:Q0VTM6"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM6"
FT                   /protein_id="CAL15482.1"
FT                   /translation="MVRIATCPQREVPMASANRKRAHILIRKGRVIDPASGRDDVADLL
FT                   IENGRLTRIGASLDAPGADIIQADGLWVLPGLVDACVHLSLPGSGRTGDIASETRAAAA
FT                   GGITHLAAQPDCGPVDSTAVVRLIREQAGQAGFARIMPIAAMTQGLLGEQLAEMSTLAR
FT                   AGCIAVGNAGGKVANALVLKRSLEYAATFDLPVMFRPQDSALSAGGCAHEGPVATRLGL
FT                   PGIPAVAESVDLSRDLLLVEATGVRAHFQQISSRDSLRLLKAAKRRGLPVTADVSIQHL
FT                   LLDESALEGFNSHCHVIPPLRSAEDRQALLEAVADGTIDAICSQHTPIGSSSKAAPFPT
FT                   TKPGMAGLDVLLSLVLQLVDEGKLDLLRALDAVTAAPARCLGIQAGQLEAGRPASLCVL
FT                   DPTAAKDLSEDWLSAGNNSPWRHAQLKGTVKLTVCQGKVSWLSD"
     MVRIATCPQR EVPMASANRK RAHILIRKGR VIDPASGRDD VADLLIENGR LTRIGASLDA        60
     PGADIIQADG LWVLPGLVDA CVHLSLPGSG RTGDIASETR AAAAGGITHL AAQPDCGPVD       120
     STAVVRLIRE QAGQAGFARI MPIAAMTQGL LGEQLAEMST LARAGCIAVG NAGGKVANAL       180
     VLKRSLEYAA TFDLPVMFRP QDSALSAGGC AHEGPVATRL GLPGIPAVAE SVDLSRDLLL       240
     VEATGVRAHF QQISSRDSLR LLKAAKRRGL PVTADVSIQH LLLDESALEG FNSHCHVIPP       300
     LRSAEDRQAL LEAVADGTID AICSQHTPIG SSSKAAPFPT TKPGMAGLDV LLSLVLQLVD       360
     EGKLDLLRAL DAVTAAPARC LGIQAGQLEA GRPASLCVLD PTAAKDLSED WLSAGNNSPW       420
     RHAQLKGTVK LTVCQGKVSW LSD                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page