(data stored in ACNUC7421 zone)

EMBL: AM286690.PYRR

AM286690.PYRR        Location/Qualifiers
FT   CDS             complement(37839..38387)
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="ABO_0036"
FT                   /product="transcriptional regulator PyrR"
FT                   /function="Pyrimidine operon attenuation"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15484"
FT                   /db_xref="GOA:Q0VTM4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM4"
FT                   /protein_id="CAL15484.1"
FT                   /translation="MDCGRTALSWDEQQLQTHLDAMATAINDQFAGKAPLLVGIESGGA
FT                   WVAQALNARLPTALPLGSLNPAFYRDDFDTRGLKPKVTPSKLPFDVDGQHILLVDDVLM
FT                   TGRTIRAAMNELFDFGRPASISLVVLFDIGRRELPIGADICGETLALPPHQRIELRGPS
FT                   PLIAEIRNLVVEDDTETRS"
     MDCGRTALSW DEQQLQTHLD AMATAINDQF AGKAPLLVGI ESGGAWVAQA LNARLPTALP        60
     LGSLNPAFYR DDFDTRGLKP KVTPSKLPFD VDGQHILLVD DVLMTGRTIR AAMNELFDFG       120
     RPASISLVVL FDIGRRELPI GADICGETLA LPPHQRIELR GPSPLIAEIR NLVVEDDTET       180
     RS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page