(data stored in ACNUC7421 zone)

EMBL: AM286690.RADC

AM286690.RADC        Location/Qualifiers
FT   CDS             232968..233642
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ABO_0214"
FT                   /product="DNA repair protein RadC homolog"
FT                   /function="involved in dna repair"
FT                   /note="(DNA repair protein (family RadC)) identified by
FT                   sequencesimilarity; putative InterPro: DNA repair protein
FT                   radC family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15662"
FT                   /db_xref="GOA:Q0VT58"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT58"
FT                   /protein_id="CAL15662.1"
FT                   /translation="MAITDWPEDERPREKLLARGAQALSDAELLAIFLRTGQQGLTAVD
FT                   LARRQLVSSGGLRAMLDLSPERMAHLPGMGVARRALLLAALELGRRYLAEPLERGLPLD
FT                   NPDKAGQLLTAQLRGLPFEVFACLFLDNKHRLIAFEKLFQGTIDAAAVYPREVVRRAME
FT                   HNAAAVILAHNHPSGVAEPSQSDHAITRRLVEALGLVEVRVLDHLVIGDGGWVSLASRG
FT                   AV"
     MAITDWPEDE RPREKLLARG AQALSDAELL AIFLRTGQQG LTAVDLARRQ LVSSGGLRAM        60
     LDLSPERMAH LPGMGVARRA LLLAALELGR RYLAEPLERG LPLDNPDKAG QLLTAQLRGL       120
     PFEVFACLFL DNKHRLIAFE KLFQGTIDAA AVYPREVVRR AMEHNAAAVI LAHNHPSGVA       180
     EPSQSDHAIT RRLVEALGLV EVRVLDHLVI GDGGWVSLAS RGAV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page