(data stored in ACNUC7421 zone)

EMBL: AM286690.RECN

AM286690.RECN        Location/Qualifiers
FT   CDS             complement(337136..338818)
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="ABO_0310"
FT                   /product="DNA repair protein RecN"
FT                   /function="May be involved in recombinational repair of
FT                   damaged DNA."
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00634 InterPro: DNA repair protein RecN"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15758"
FT                   /db_xref="GOA:Q0VSU0"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU0"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00634"
FT                   /protein_id="CAL15758.1"
FT                   /translation="MQRNTMLTHLSVRHFATVDQLELEPENGLTAISGETGAGKSVIID
FT                   ALGLTLGNRADSSIVRHGHDRAEVLATFDLRNNAAAQQWLIERELDDEEQCLLRRTVRA
FT                   DGRSRAYVNGTPTPLSEVRELGERLISIHSQHEHQALLKKDAHRQLLDNFAHARDLANS
FT                   VREHWRHWQRARRAHDDALNQAREQNEKEELLRFQLEELDALALQDGELEQLELEQQRL
FT                   GNAENLIRLCQQSLDALYEGEDGTCNDHLSQVSHWLDDARNNDGDLGSIADTVESARLQ
FT                   VEAAADDLRHYLEKLDLDPARLSQVEERLSQSYTLARKHRVRPQELVEHHRSLLAESDT
FT                   LGNVDAQLHALAEQETTAQQHYMDSARKLTKARRSAAKTLSQQVQKQLTALGMKAAQLD
FT                   ACLSECPPSLEGLEEVEFLFTANPGQPLKPLGKVASGGELSRVSLAIQVICARNLTVPS
FT                   LVFDEVDVGVGGGVAEIVGRLLRELGQHAQVLCITHQPQVASQGHQHWQVHKIQEDETT
FT                   HTRIQELDDAARVEELARMLGGVEITESTRNHAKEMLSKAQAA"
     MQRNTMLTHL SVRHFATVDQ LELEPENGLT AISGETGAGK SVIIDALGLT LGNRADSSIV        60
     RHGHDRAEVL ATFDLRNNAA AQQWLIEREL DDEEQCLLRR TVRADGRSRA YVNGTPTPLS       120
     EVRELGERLI SIHSQHEHQA LLKKDAHRQL LDNFAHARDL ANSVREHWRH WQRARRAHDD       180
     ALNQAREQNE KEELLRFQLE ELDALALQDG ELEQLELEQQ RLGNAENLIR LCQQSLDALY       240
     EGEDGTCNDH LSQVSHWLDD ARNNDGDLGS IADTVESARL QVEAAADDLR HYLEKLDLDP       300
     ARLSQVEERL SQSYTLARKH RVRPQELVEH HRSLLAESDT LGNVDAQLHA LAEQETTAQQ       360
     HYMDSARKLT KARRSAAKTL SQQVQKQLTA LGMKAAQLDA CLSECPPSLE GLEEVEFLFT       420
     ANPGQPLKPL GKVASGGELS RVSLAIQVIC ARNLTVPSLV FDEVDVGVGG GVAEIVGRLL       480
     RELGQHAQVL CITHQPQVAS QGHQHWQVHK IQEDETTHTR IQELDDAARV EELARMLGGV       540
     EITESTRNHA KEMLSKAQAA                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page