(data stored in ACNUC7421 zone)

EMBL: AM286690.RIBF

AM286690.RIBF        Location/Qualifiers
FT   CDS             497855..498832
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ABO_0458"
FT                   /product="FAD pyrophosphorylase"
FT                   /function="atp + riboflavin = adp + fmn / atp + fmn =
FT                   diphosphate + fad"
FT                   /EC_number="2.7.7.2"
FT                   /note="(riboflavin biosynthesis protein RibF) identified by
FT                   sequence similarity; putative InterPro: Riboflavin kinase /
FT                   FAD synthetase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15906"
FT                   /db_xref="GOA:Q0VSE2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSE2"
FT                   /protein_id="CAL15906.1"
FT                   /translation="MRLIRGIHNLRDTHRGCVATIGNFDGVHQGHQRILDQVIAEARGR
FT                   GLKATVMLFEPQPQEFFSPQTAPPRLMSLRDKLIALREAGVDQVLCLRFDERFRSLTAQ
FT                   AFVKGLLVDGLGVEYLVVGDDFRFGCGRDGDFSYLQQAGKQFDFAVTDTATCEIEGDRV
FT                   SSTRVRAALREGDFALAERLLGRPFAISGRVRHGDKIGRTLGLPTVNLALKRLQSPLHG
FT                   VFAVAVTGAGLTDQPGAANMGTRPTVNGTENRLEVYLLDYGDPAGSSGDAQCSHQDSLY
FT                   GAHLTVAFRHYVRPEEKFADLDLLKTAIRQDINAVRAFFDMPTV"
     MRLIRGIHNL RDTHRGCVAT IGNFDGVHQG HQRILDQVIA EARGRGLKAT VMLFEPQPQE        60
     FFSPQTAPPR LMSLRDKLIA LREAGVDQVL CLRFDERFRS LTAQAFVKGL LVDGLGVEYL       120
     VVGDDFRFGC GRDGDFSYLQ QAGKQFDFAV TDTATCEIEG DRVSSTRVRA ALREGDFALA       180
     ERLLGRPFAI SGRVRHGDKI GRTLGLPTVN LALKRLQSPL HGVFAVAVTG AGLTDQPGAA       240
     NMGTRPTVNG TENRLEVYLL DYGDPAGSSG DAQCSHQDSL YGAHLTVAFR HYVRPEEKFA       300
     DLDLLKTAIR QDINAVRAFF DMPTV                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page